DFFB anticorps
-
- Antigène Voir toutes DFFB Anticorps
- DFFB (DNA Fragmentation Factor, 40kDa, beta Polypeptide (Caspase-Activated DNase) (DFFB))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DFFB est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
- Top Product
- Discover our top product DFFB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DFFB Blocking Peptide, catalog no. 33R-2821, is also available for use as a blocking control in assays to test for specificity of this DFFB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DFFB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DFFB (DNA Fragmentation Factor, 40kDa, beta Polypeptide (Caspase-Activated DNase) (DFFB))
- Autre désignation
- DFFB (DFFB Produits)
- Synonymes
- anticorps CAD, anticorps CPAN, anticorps DFF-40, anticorps DFF2, anticorps DFF40, anticorps LOC100223514, anticorps 40kDa, anticorps 5730477D02Rik, anticorps Didff, anticorps Cad, anticorps carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase, anticorps DNA fragmentation factor subunit beta, anticorps DNA fragmentation factor, beta polypeptide (caspase-activated DNase), anticorps DNA fragmentation factor, beta subunit, anticorps CAD, anticorps DFFB, anticorps dffb, anticorps LOC100223514, anticorps Dffb
- Sujet
- DFFB is a nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. DFFB degrades naked DNA and induces apoptotic morphology.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Apoptose, Caspase Cascade in Apoptosis
-