PRKAA1 anticorps (Middle Region)

N° du produit ABIN634505

Détail du produit anti-PRKAA1 anticorps

Antigène: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKAA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKAA1 antibody was raised against the middle region of PRKAA1

Purification: Affinity purified

Immunogène: PRKAA1 antibody was raised using the middle region of PRKAA1 corresponding to a region with amino acids SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKAA1 Blocking Peptide, catalog no. 33R-8915, is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKAA1

Antigène: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Autre désignation: PRKAA1 (PRKAA1 Produits)

Synonymes: anticorps AMPK, anticorps AMPKa1, anticorps cb116, anticorps im:7154392, anticorps sb:cb130, anticorps wu:fa94c10, anticorps AMPK1, anticorps AMPKalpha1, anticorps AI194361, anticorps AI450832, anticorps AL024255, anticorps C130083N04Rik, anticorps ampk, anticorps ampka1, anticorps PRKAA1, anticorps protein kinase AMP-activated catalytic subunit alpha 1, anticorps protein kinase, AMP-activated, alpha 1 catalytic subunit, anticorps protein kinase, AMP-activated, alpha 1 catalytic subunit L homeolog, anticorps PRKAA1, anticorps prkaa1, anticorps Prkaa1, anticorps prkaa1.L

Sujet: PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK).

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, L'effet Warburg