ATP6V0A2 anticorps (N-Term)

N° du produit ABIN634572

Détail du produit anti-ATP6V0A2 anticorps

Antigène: ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6V0A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 V6 2 antibody was raised against the N terminal of ATP6 6 2

Purification: Affinity purified

Immunogène: ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6V0A2 Blocking Peptide, catalog no. 33R-4080, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6V0A2

Antigène: ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))

Autre désignation: ATP6V0A2 (ATP6V0A2 Produits)

Synonymes: anticorps A2, anticorps ARCL, anticorps ARCL2A, anticorps ATP6A2, anticorps ATP6N1D, anticorps J6B7, anticorps RTF, anticorps STV1, anticorps TJ6, anticorps TJ6M, anticorps TJ6S, anticorps VPH1, anticorps WSS, anticorps 8430408C20Rik, anticorps AI385560, anticorps ATP6a2, anticorps AW489264, anticorps Atp6n1d, anticorps Atp6n2, anticorps C76904, anticorps ISF, anticorps SHIF, anticorps Stv1, anticorps TJ6s, anticorps Tj6, anticorps V-ATPase 116 kDa, anticorps V-ATPase a2, anticorps Cc1-3, anticorps J6b7, anticorps atp6v0a2, anticorps si:ch211-199i18.4, anticorps si:ch211-106a19.2, anticorps ATPase H+ transporting V0 subunit a2, anticorps ATPase, H+ transporting, lysosomal V0 subunit A2, anticorps ATPase, H+ transporting, lysosomal V0 subunit a2a, anticorps ATPase, H+ transporting, lysosomal V0 subunit a2b, anticorps ATP6V0A2, anticorps Atp6v0a2, anticorps atp6v0a2a, anticorps atp6v0a2b

Sujet: The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells.

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport