ATG5 anticorps

N° du produit ABIN634588

Cet anticorps Lapin Polyclonal détecte spécifiquement ATG5 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour ATG5 anticorps (ABIN634588)

Antigène: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATG5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ATG5 anticorps

Purification: Affinity purified

Immunogène: ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATG5 Blocking Peptide, (ABIN937485), is also available for use as a blocking control in assays to test for specificity of this ATG5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATG5

Antigène: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Autre désignation: ATG5

Sujet: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Autophagy