ATG5 anticorps

N° du produit ABIN634588

Détail du produit anti-ATG5 anticorps

Antigène: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATG5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATG5 Blocking Peptide, catalog no. 33R-2099, is also available for use as a blocking control in assays to test for specificity of this ATG5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATG5

Antigène: ATG5 (ATG5 Autophagy Related 5 (ATG5))

Autre désignation: ATG5 (ATG5 Produits)

Synonymes: anticorps APG5, anticorps APG5-LIKE, anticorps APG5L, anticorps ASP, anticorps hAPG5, anticorps ATG5, anticorps CG1643, anticorps DmAtg5, anticorps Dmel\\CG1643, anticorps atg5, anticorps 2010107M05Rik, anticorps 3110067M24Rik, anticorps AW319544, anticorps Apg5l, anticorps Atg5l, anticorps C88337, anticorps Paddy, anticorps apg5l, anticorps zgc:100934, anticorps ATATG5, anticorps AUTOPHAGY 5, anticorps MKP11.20, anticorps MKP11_20, anticorps autophagy related 5, anticorps Autophagy-related 5, anticorps ATG5 autophagy related 5 homolog (S. cerevisiae), anticorps autophagy related 5 L homeolog, anticorps similar to S. cerevisiae ATG5 (YPL149W) which nucleates preautophagosome formation as a conjugate with Atg12, anticorps autophagy protein Apg5 family, anticorps ATG5, anticorps Atg5, anticorps atg5, anticorps atg5.L, anticorps APG5

Sujet: ATG5 is required for autophagy. It conjugates to ATG12 and associates with isolation membrane to form cup-shaped isolation membrane and autophagosome. The conjugate detaches from the membrane immediately before or after autophagosome formation is completed. ATG5 may play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Production of Molecular Mediator of Immune Response, Autophagy