COL6A1 anticorps (Middle Region)

N° du produit ABIN634616

Détail du produit anti-COL6A1 anticorps

Antigène: COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COL6A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Collagen Type VI Alpha 1 antibody was raised against the middle region of COL6 A1

Purification: Affinity purified

Immunogène: Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6 A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Collagen Type VI Alpha 1 Blocking Peptide, catalog no. 33R-1097, is also available for use as a blocking control in assays to test for specificity of this Collagen Type VI Alpha 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COL0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COL6A1

Antigène: COL6A1 (Collagen, Type VI, alpha 1 (COL6A1))

Autre désignation: Collagen Type VI alpha 1 (COL6A1 Produits)

Synonymes: anticorps CBR, anticorps SDR21C1, anticorps hCBR1, anticorps OPLL, anticorps AI747156, anticorps Col6a-1, anticorps RGD1565398, anticorps COL6A1, anticorps carbonyl reductase 1, anticorps collagen type VI alpha 1 chain, anticorps collagen, type VI, alpha 1, anticorps collagen, type VI, alpha 1 L homeolog, anticorps collagen type VI alpha 3 chain, anticorps collagen alpha-1(VI) chain, anticorps CBR1, anticorps COL6A1, anticorps Col6a1, anticorps col6a1.L, anticorps COL6A3, anticorps col6a1, anticorps LOC100623720

Sujet: The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils.

Poids moléculaire: 106 kDa (MW of target protein)

Pathways: Growth Factor Binding, SARS-CoV-2 Protein Interactome