IFT140 anticorps
-
- Antigène Voir toutes IFT140 Anticorps
- IFT140 (Intraflagellar Transport 140 Homolog (IFT140))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IFT140 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- IFT140 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
- Top Product
- Discover our top product IFT140 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IFT140 Blocking Peptide, catalog no. 33R-9681, is also available for use as a blocking control in assays to test for specificity of this IFT140 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT140 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IFT140 (Intraflagellar Transport 140 Homolog (IFT140))
- Autre désignation
- IFT140 (IFT140 Produits)
- Synonymes
- anticorps zC153C20.3, anticorps si:ch211-153c20.3, anticorps gs114, anticorps wdtc2, anticorps c305c8.4, anticorps c380f5.1, anticorps AI661311, anticorps Tce5, anticorps Wdtc2, anticorps mKIAA0590, anticorps MZSDS, anticorps WDTC2, anticorps c305C8.4, anticorps c380F5.1, anticorps intraflagellar transport 140 homolog (Chlamydomonas), anticorps intraflagellar transport 140, anticorps intraflagellar transport protein 140 homolog, anticorps ift140, anticorps IFT140, anticorps LOC100636864, anticorps LOC100645502, anticorps Ift140
- Sujet
- IFT140 contains 9 TPR repeats and 5 WD repeats. The function of the IFT140 protein remains unknown.
- Poids moléculaire
- 165 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog
-