Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

PPP2R1A anticorps

PPP2R1A Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN634652
  • Antigène Voir toutes PPP2R1A Anticorps
    PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
    Reactivité
    • 69
    • 40
    • 21
    • 12
    • 8
    • 6
    • 5
    • 5
    • 5
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 66
    • 3
    • 2
    • 1
    Lapin
    Clonalité
    • 70
    • 2
    Polyclonal
    Conjugué
    • 36
    • 5
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp PPP2R1A est non-conjugé
    Application
    • 56
    • 21
    • 13
    • 13
    • 8
    • 8
    • 8
    • 7
    • 6
    • 6
    • 5
    • 2
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Affinity purified
    Immunogène
    PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYP
    Top Product
    Discover our top product PPP2R1A Anticorps primaire
  • Indications d'application
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Commentaires

    PPP2R1A Blocking Peptide, catalog no. 33R-4262, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Conseil sur la manipulation
    Avoid repeated freeze/thaw cycles.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Antigène
    PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
    Autre désignation
    PPP2R1A (PPP2R1A Produits)
    Synonymes
    anticorps PP2A-Aalpha, anticorps PP2AAALPHA, anticorps PR65A, anticorps PR65, anticorps pp2a-aalpha, anticorps pp2aaalpha, anticorps ppp2r1a, anticorps pr65a, anticorps wu:fa02h04, anticorps zgc:56296, anticorps 6330556D22Rik, anticorps PP2A, anticorps ppp2r1a-a, anticorps ppp2r1a-b, anticorps protein phosphatase 2 scaffold subunit Aalpha, anticorps protein phosphatase 2 scaffold subunit A alpha, anticorps protein phosphatase 2 regulatory subunit A, alpha L homeolog, anticorps protein phosphatase 2 regulatory subunit A, alpha, anticorps protein phosphatase 2, regulatory subunit A, beta a, anticorps serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform, anticorps protein phosphatase 2, regulatory subunit A, alpha isoform, anticorps protein phosphatase 2, regulatory subunit A, alpha, anticorps protein phosphatase 2 regulatory subunit A, alpha S homeolog, anticorps PPP2R1A, anticorps Ppp2r1a, anticorps ppp2r1a.L, anticorps ppp2r1a, anticorps ppp2r1ba, anticorps LOC583227, anticorps ppp2r1a.S
    Sujet
    PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. PPP2R1A is an alpha isoform of the constant regulatory subunit A.
    Poids moléculaire
    65 kDa (MW of target protein)
    Pathways
    Signalisation PI3K-Akt, Mitotic G1-G1/S Phases, M Phase, Hepatitis C, Toll-Like Receptors Cascades
Vous êtes ici:
Support technique