PPP2R1A anticorps
-
- Antigène Voir toutes PPP2R1A Anticorps
- PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP2R1A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYP
- Top Product
- Discover our top product PPP2R1A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP2R1A Blocking Peptide, catalog no. 33R-4262, is also available for use as a blocking control in assays to test for specificity of this PPP2R1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP2R1A (Protein Phosphatase 2, Regulatory Subunit A, alpha (PPP2R1A))
- Autre désignation
- PPP2R1A (PPP2R1A Produits)
- Synonymes
- anticorps PP2A-Aalpha, anticorps PP2AAALPHA, anticorps PR65A, anticorps PR65, anticorps pp2a-aalpha, anticorps pp2aaalpha, anticorps ppp2r1a, anticorps pr65a, anticorps wu:fa02h04, anticorps zgc:56296, anticorps 6330556D22Rik, anticorps PP2A, anticorps ppp2r1a-a, anticorps ppp2r1a-b, anticorps protein phosphatase 2 scaffold subunit Aalpha, anticorps protein phosphatase 2 scaffold subunit A alpha, anticorps protein phosphatase 2 regulatory subunit A, alpha L homeolog, anticorps protein phosphatase 2 regulatory subunit A, alpha, anticorps protein phosphatase 2, regulatory subunit A, beta a, anticorps serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform, anticorps protein phosphatase 2, regulatory subunit A, alpha isoform, anticorps protein phosphatase 2, regulatory subunit A, alpha, anticorps protein phosphatase 2 regulatory subunit A, alpha S homeolog, anticorps PPP2R1A, anticorps Ppp2r1a, anticorps ppp2r1a.L, anticorps ppp2r1a, anticorps ppp2r1ba, anticorps LOC583227, anticorps ppp2r1a.S
- Sujet
- PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. PPP2R1A is an alpha isoform of the constant regulatory subunit A.
- Poids moléculaire
- 65 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt, Mitotic G1-G1/S Phases, M Phase, Hepatitis C, Toll-Like Receptors Cascades
-