Connexin 43/GJA1 anticorps (Middle Region)
-
- Antigène Voir toutes Connexin 43/GJA1 (GJA1) Anticorps
- Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Connexin 43/GJA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GJA1 antibody was raised against the middle region of GJA1
- Purification
- Affinity purified
- Immunogène
- GJA1 antibody was raised using the middle region of GJA1 corresponding to a region with amino acids GSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASS
- Top Product
- Discover our top product GJA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GJA1 Blocking Peptide, catalog no. 33R-3592, is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))
- Autre désignation
- GJA1 (GJA1 Produits)
- Synonymes
- anticorps AVSD3, anticorps CX43, anticorps DFNB38, anticorps GJAL, anticorps HLHS1, anticorps HSS, anticorps ODDD, anticorps Cx43, anticorps AU042049, anticorps AW546267, anticorps Cnx43, anticorps Cx43alpha1, anticorps Gja-1, anticorps Npm1, anticorps connexin43, anticorps cx43a1, anticorps gja1, anticorps zfCx43.3, anticorps connexin 43, anticorps gja1-A, anticorps cx43, anticorps gjal, anticorps oddd, anticorps dfnb38, anticorps gap junction protein alpha 1, anticorps gap junction protein, alpha 1, anticorps connexin 43, anticorps gap junction protein alpha 1 L homeolog, anticorps CONNEXIN 43 protein, anticorps GJA1, anticorps Gja1, anticorps cx43, anticorps gja1.L, anticorps gja1, anticorps CONNEXIN 43
- Sujet
- Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.
- Poids moléculaire
- 43 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Myometrial Relaxation and Contraction, Cell-Cell Junction Organization
-