KIT Ligand anticorps (Middle Region)

N° du produit ABIN634669

Détail du produit anti-KIT Ligand anticorps

Antigène: KIT Ligand (KITLG)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIT Ligand est non-conjugé

Application: Western Blotting (WB)

Specificité: KITLG antibody was raised against the middle region of KITLG

Purification: Affinity purified

Immunogène: KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KITLG Blocking Peptide, catalog no. 33R-9145, is also available for use as a blocking control in assays to test for specificity of this KITLG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIT Ligand

Antigène: KIT Ligand (KITLG)

Autre désignation: KITLG (KITLG Produits)

Synonymes: anticorps Xkl-1, anticorps Xsl, anticorps Xsl-1, anticorps Xsl-2, anticorps steel, anticorps KITLG, anticorps SCF, anticorps kitl, anticorps kl-1, anticorps mgf, anticorps scf, anticorps FPH2, anticorps KL-1, anticorps Kitl, anticorps MGF, anticorps SF, anticorps SHEP7, anticorps Clo, anticorps Con, anticorps Gb, anticorps Kitlg, anticorps Mgf, anticorps SLF, anticorps Sl, anticorps blz, anticorps contrasted, anticorps 710-712, anticorps CSF, anticorps KITL, anticorps KIT ligand L homeolog, anticorps KIT ligand, anticorps kit ligand, anticorps kitlg.L, anticorps KITLG, anticorps kitlg, anticorps Kitl, anticorps Kitlg

Sujet: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway