Leptin anticorps (Middle Region)

N° du produit ABIN634796

Détail du produit anti-Leptin anticorps

Antigène: Leptin (LEP)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Leptin est non-conjugé

Application: Western Blotting (WB)

Specificité: Leptin antibody was raised against the middle region of LEP

Purification: Affinity purified

Immunogène: Leptin antibody was raised using the middle region of LEP corresponding to a region with amino acids LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Leptin Blocking Peptide, catalog no. 33R-5033, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Leptin

Antigène: Leptin (LEP)

Autre désignation: Leptin (LEP Produits)

Synonymes: anticorps ob, anticorps obese, anticorps LEPD, anticorps OB, anticorps OBS, anticorps leptin, anticorps Lep, anticorps LEP, anticorps lep

Sujet: LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process