GDF15 anticorps (N-Term)

N° du produit ABIN634798

Détail du produit anti-GDF15 anticorps

Antigène: GDF15 (Growth Differentiation Factor 15 (GDF15))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GDF15 est non-conjugé

Application: Western Blotting (WB)

Specificité: GDF15 antibody was raised against the N terminal of GDF15

Purification: Affinity purified

Immunogène: GDF15 antibody was raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GDF15 Blocking Peptide, catalog no. 33R-1525, is also available for use as a blocking control in assays to test for specificity of this GDF15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GDF15

Antigène: GDF15 (Growth Differentiation Factor 15 (GDF15))

Autre désignation: GDF15 (GDF15 Produits)

Synonymes: anticorps GDF15, anticorps GDF-15, anticorps MIC-1, anticorps MIC1, anticorps NAG-1, anticorps PDF, anticorps PLAB, anticorps PTGFB, anticorps SBF, anticorps growth differentiation factor 15, anticorps GDF15, anticorps Gdf15

Sujet: Bone morphogenetic proteins are members of the transforming growth factor-beta superfamily and regulate tissue differentiation and maintenance.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome