Growth Hormone 2 anticorps (Middle Region)

N° du produit ABIN634800

Détail du produit anti-Growth Hormone 2 anticorps

Antigène: Growth Hormone 2 (GH2)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Growth Hormone 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Growth Hormone 2 antibody was raised against the middle region of GH2

Purification: Affinity purified

Immunogène: Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Growth Hormone 2 Blocking Peptide, catalog no. 33R-4888, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Growth Hormone 2

Antigène: Growth Hormone 2 (GH2)

Autre désignation: Growth Hormone 2 (GH2 Produits)

Synonymes: anticorps GH-V, anticorps GHL, anticorps GHV, anticorps hGH-V, anticorps growth hormone 2, anticorps GH2

Classe de substances: Hormone

Sujet: GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalistation JAK/STAT, Response to Growth Hormone Stimulus