FAM20C anticorps (Middle Region)
-
- Antigène Voir toutes FAM20C Anticorps
- FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM20C est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM20 C antibody was raised against the middle region of FAM20
- Purification
- Affinity purified
- Immunogène
- FAM20 C antibody was raised using the middle region of FAM20 corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY
- Top Product
- Discover our top product FAM20C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM20C Blocking Peptide, catalog no. 33R-1689, is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))
- Autre désignation
- FAM20C (FAM20C Produits)
- Synonymes
- anticorps DMP-4, anticorps DMP4, anticorps GEF-CK, anticorps RNS, anticorps C76981, anticorps mKIAA4081, anticorps RGD1311980, anticorps si:ch73-266a4.1, anticorps FAM20C, golgi associated secretory pathway kinase, anticorps family with sequence similarity 20, member C, anticorps family with sequence similarity 20, member Cb, anticorps FAM20C, anticorps Fam20c, anticorps fam20cb
- Sujet
- FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.
- Poids moléculaire
- 66 kDa (MW of target protein)
-