ORAI1 anticorps (Middle Region)

N° du produit ABIN634999

Détail du produit anti-ORAI1 anticorps

Antigène: ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ORAI1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ORAI1 antibody was raised against the middle region of ORAI1

Purification: Affinity purified

Immunogène: ORAI1 antibody was raised using the middle region of ORAI1 corresponding to a region with amino acids IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ORAI1 Blocking Peptide, catalog no. 33R-3979, is also available for use as a blocking control in assays to test for specificity of this ORAI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORAI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ORAI1

Antigène: ORAI1 (ORAI Calcium Release-Activated Calcium Modulator 1 (ORAI1))

Autre désignation: ORAI1 (ORAI1 Produits)

Synonymes: anticorps CRACM1, anticorps ORAT1, anticorps TMEM142A, anticorps RGD1311873, anticorps D730049H07Rik, anticorps Tmem142a, anticorps orai-1, anticorps im:7146264, anticorps orai1, anticorps tmem142a, anticorps zgc:109721, anticorps orai2, anticorps ORAI1, anticorps LOC100218031, anticorps ORAI calcium release-activated calcium modulator 1, anticorps ORAI calcium release-activated calcium modulator 1b, anticorps ORAI calcium release-activated calcium modulator 1 S homeolog, anticorps ORAI1, anticorps Orai1, anticorps orai1b, anticorps orai1.S, anticorps orai1

Sujet: ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: TCR Signaling, BCR Signaling