RNF121 anticorps (Middle Region)

N° du produit ABIN635123

Détail du produit anti-RNF121 anticorps

Antigène: RNF121 (Ring Finger Protein 121 (RNF121))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF121 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF121 antibody was raised against the middle region of RNF121

Purification: Affinity purified

Immunogène: RNF121 antibody was raised using the middle region of RNF121 corresponding to a region with amino acids GMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF121 Blocking Peptide, catalog no. 33R-3438, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF121 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF121

Antigène: RNF121 (Ring Finger Protein 121 (RNF121))

Autre désignation: RNF121 (RNF121 Produits)

Synonymes: anticorps 4930544L10Rik, anticorps im:6907121, anticorps si:ch73-373k7.1, anticorps ring finger protein 121, anticorps RING finger protein 121, anticorps RNF121, anticorps rnf-121, anticorps Rnf121, anticorps rnf121

Sujet: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Three of them are supported by at least two independent transcripts or ESTs, the full length natures of others are not clear.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling