Vip anticorps (Middle Region)

N° du produit ABIN635234

Détail du produit anti-Vip anticorps

Antigène: Vip (Vasoactive Intestinal Peptide (Vip))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Vip est non-conjugé

Application: Western Blotting (WB)

Specificité: VIP antibody was raised against the middle region of VIP

Purification: Affinity purified

Immunogène: VIP antibody was raised using the middle region of VIP corresponding to a region with amino acids VPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VIP Blocking Peptide, catalog no. 33R-9742, is also available for use as a blocking control in assays to test for specificity of this VIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Vip

Antigène: Vip (Vasoactive Intestinal Peptide (Vip))

Autre désignation: VIP (Vip Produits)

Synonymes: anticorps PHM27, anticorps vip1, anticorps zgc:171463, anticorps VIP, anticorps vip-A, anticorps PHI, anticorps vasoactive intestinal peptide, anticorps vasoactive intestinal peptide L homeolog, anticorps vasoactive intestinal polypeptide, anticorps VIP, anticorps Vip, anticorps vip, anticorps vip.L

Sujet: The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Poids moléculaire: 3 kDa (MW of target protein)

Pathways: Hormone Activity, cAMP Metabolic Process