SLC39A4 anticorps
-
- Antigène Voir toutes SLC39A4 Anticorps
- SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC39A4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC39 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED
- Top Product
- Discover our top product SLC39A4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC39A4 Blocking Peptide, catalog no. 33R-9661, is also available for use as a blocking control in assays to test for specificity of this SLC39A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))
- Autre désignation
- SLC39A4 (SLC39A4 Produits)
- Synonymes
- anticorps AEZ, anticorps AWMS2, anticorps ZIP4, anticorps 1600025H15Rik, anticorps AU041686, anticorps solute carrier family 39 member 4, anticorps solute carrier family 39 (zinc transporter), member 4, anticorps SLC39A4, anticorps slc39a4, anticorps Slc39a4
- Sujet
- SLC39A4 is a member of the zinc/iron-regulated transporter-like protein (ZIP) family. The transmembrane protein is required for zinc uptake in the intestine. Mutations in the gene encoding SLC39A4 result in acrodermatitis enteropathica, a rare inherited defect in the absorption of dietary zinc.
- Poids moléculaire
- 66 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Autophagy
-