SLC39A4 anticorps

N° du produit ABIN635269

Cet anticorps Lapin Polyclonal détecte spécifiquement SLC39A4 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SLC39A4 anticorps (ABIN635269)

Antigène: SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC39A4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC39A4 anticorps

Purification: Affinity purified

Immunogène: SLC39 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC39A4 Blocking Peptide, (ABIN5616248), is also available for use as a blocking control in assays to test for specificity of this SLC39A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC39A4

Antigène: SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))

Autre désignation: SLC39A4

Sujet: SLC39A4 is a member of the zinc/iron-regulated transporter-like protein (ZIP) family. The transmembrane protein is required for zinc uptake in the intestine. Mutations in the gene encoding SLC39A4 result in acrodermatitis enteropathica, a rare inherited defect in the absorption of dietary zinc.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Autophagy