ABCB4 anticorps

N° du produit ABIN635283

Détail du produit anti-ABCB4 anticorps

Antigène: ABCB4 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCB4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCB4 Blocking Peptide, catalog no. 33R-1187, is also available for use as a blocking control in assays to test for specificity of this ABCB4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCB4

Antigène: ABCB4 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4))

Autre désignation: ABCB4 (ABCB4 Produits)

Synonymes: anticorps ABC21, anticorps GBD1, anticorps ICP3, anticorps MDR2, anticorps MDR2/3, anticorps MDR3, anticorps PFIC-3, anticorps PGY3, anticorps zgc:172149, anticorps Mdr2, anticorps Pgy-2, anticorps Pgy2, anticorps mdr-2, anticorps Pgy3, anticorps ABCB4a, anticorps DEFB1, anticorps PGP2, anticorps PGY2, anticorps PGP3, anticorps ABCB4, anticorps RUNDC3B, anticorps ATP binding cassette subfamily B member 4, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 4, anticorps beta-defensin 1-like, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 1B, anticorps RUN domain-containing protein 3B, anticorps ABCB4, anticorps abcb4, anticorps Abcb4, anticorps LOC100861170, anticorps Abcb1b, anticorps LOC101122517

Sujet: ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily.

Poids moléculaire: 141 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha