FURIN anticorps

N° du produit ABIN635308

Détail du produit anti-FURIN anticorps

Antigène: FURIN (Furin (Paired Basic Amino Acid Cleaving Enzyme) (FURIN))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FURIN est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FURIN Blocking Peptide, catalog no. 33R-7864, is also available for use as a blocking control in assays to test for specificity of this FURIN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FURIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FURIN

Antigène: FURIN (Furin (Paired Basic Amino Acid Cleaving Enzyme) (FURIN))

Autre désignation: FURIN (FURIN Produits)

Synonymes: anticorps FURIN, anticorps furin, anticorps si:dkey-281a24.5, anticorps FUR, anticorps LOC100220259, anticorps PACE, anticorps spc1, anticorps xfurin, anticorps MGC82710, anticorps PCSK3, anticorps SPC1, anticorps 9130404I01Rik, anticorps Fur, anticorps Pcsk3, anticorps Pace, anticorps furin, paired basic amino acid cleaving enzyme, anticorps furin (paired basic amino acid cleaving enzyme) a, anticorps furin (paired basic amino acid cleaving enzyme) b, anticorps furin, paired basic amino acid cleaving enzyme L homeolog, anticorps furin (paired basic amino acid cleaving enzyme), anticorps FURIN, anticorps furina, anticorps furinb, anticorps furin, anticorps furin.L, anticorps Furin

Sujet: The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products.

Poids moléculaire: 74 kDa (MW of target protein)

Pathways: Signalisation Notch, Neurotrophin Signaling Pathway