RNASE1 anticorps

N° du produit ABIN635680

Détail du produit anti-RNASE1 anticorps

Antigène: RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNASE1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RNASE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNASE1 Blocking Peptide, catalog no. 33R-5686, is also available for use as a blocking control in assays to test for specificity of this RNASE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNASE1

Antigène: RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))

Autre désignation: RNASE1 (RNASE1 Produits)

Synonymes: anticorps RNASE1, anticorps RNS1, anticorps ATRNS1, anticorps RIBONUCLEASE 1, anticorps T17M13.16, anticorps T17M13_16, anticorps ribonuclease 1, anticorps RIB1, anticorps AI574248, anticorps Rib-1, anticorps Rib1, anticorps SRN, anticorps ribonuclease A family member 1, pancreatic, anticorps ribonuclease pancreatic-like, anticorps ribonuclease A family member k6, anticorps Ribonuclease 1, anticorps ribonuclease 1, anticorps ribonuclease, RNase A family, 1 (pancreatic), anticorps ribonuclease pancreatic, anticorps RNASE1, anticorps LOC475395, anticorps RNASE6, anticorps Rnase1, anticorps RNS1, anticorps LOC101113761

Sujet: This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases.

Poids moléculaire: 15 kDa (MW of target protein)