DLL3 anticorps

N° du produit ABIN635694

Détail du produit anti-DLL3 anticorps

Antigène: DLL3 (delta Like Protein 3 (DLL3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLL3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLL3 Blocking Peptide, catalog no. 33R-6609, is also available for use as a blocking control in assays to test for specificity of this DLL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLL3

Antigène: DLL3 (delta Like Protein 3 (DLL3))

Autre désignation: DLL3 (DLL3 Produits)

Synonymes: anticorps SCDO1, anticorps pu, anticorps pudgy, anticorps delta like canonical Notch ligand 3, anticorps delta-like 3 (Drosophila), anticorps DLL3, anticorps Dll3

Sujet: DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1.

Poids moléculaire: 54 kDa (MW of target protein)

Pathways: Signalisation Notch