ChT anticorps

N° du produit ABIN635784

Détail du produit anti-ChT anticorps

Antigène: ChT (High Affinity Choline Transporter (ChT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ChT est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC5 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC5A7 Blocking Peptide, catalog no. 33R-1884, is also available for use as a blocking control in assays to test for specificity of this SLC5A7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ChT

Antigène: ChT (High Affinity Choline Transporter (ChT))

Autre désignation: SLC5A7 (ChT Produits)

Synonymes: anticorps CHT, anticorps CHT1, anticorps HMN7A, anticorps hCHT, anticorps Cht1, anticorps solute carrier family 5 member 7, anticorps solute carrier family 5 (choline transporter), member 7, anticorps SLC5A7, anticorps Slc5a7

Sujet: Choline is a direct precursor of acetylcholine (ACh), a neurotransmitter of the central and peripheral nervous system that regulates a variety of autonomic, cognitive, and motor functions. SLC5A7 is a Na(+)- and Cl(-)- dependent high-affinity transporter that mediates the uptake of choline for acetylcholine synthesis in cholinergic neurons.

Poids moléculaire: 63 kDa (MW of target protein)