Growth Hormone Receptor anticorps (N-Term)

N° du produit ABIN635863

Détail du produit anti-Growth Hormone Receptor anticorps

Antigène: Growth Hormone Receptor (GHR)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Growth Hormone Receptor est non-conjugé

Application: Western Blotting (WB)

Specificité: GHR antibody was raised against the N terminal of GHR

Purification: Affinity purified

Immunogène: GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GHR Blocking Peptide, catalog no. 33R-5341, is also available for use as a blocking control in assays to test for specificity of this GHR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Growth Hormone Receptor

Antigène: Growth Hormone Receptor (GHR)

Autre désignation: GHR (GHR Produits)

Synonymes: anticorps GHBP, anticorps AA986417, anticorps GHR/BP, anticorps GHR, anticorps ghr, anticorps ghr.a, anticorps zgc:162141, anticorps growth hormone receptor, anticorps growth hormone receptor L homeolog, anticorps growth hormone receptor a, anticorps GHR, anticorps Ghr, anticorps ghr.L, anticorps ghr, anticorps ghra

Sujet: GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalistation JAK/STAT, Response to Growth Hormone Stimulus