GPAA1 anticorps

N° du produit ABIN635865

Détail du produit anti-GPAA1 anticorps

Antigène: GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPAA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: GPAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPAA1 Blocking Peptide, catalog no. 33R-4996, is also available for use as a blocking control in assays to test for specificity of this GPAA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPAA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPAA1

Antigène: GPAA1 (GPI Anchor Attachment Protein 1 (GPAA1))

Autre désignation: GPAA1 (GPAA1 Produits)

Synonymes: anticorps GAA1, anticorps hGAA1, anticorps C80044, anticorps mGAA1, anticorps glycosylphosphatidylinositol anchor attachment 1, anticorps GPI anchor attachment protein 1, anticorps GPAA1, anticorps Gpaa1

Sujet: Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Maintenance of Protein Location, SARS-CoV-2 Protein Interactome