SRD5A2 anticorps (N-Term)
-
- Antigène Voir toutes SRD5A2 Anticorps
- SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRD5A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SRD5 A2 antibody was raised against the N terminal of SRD5 2
- Purification
- Affinity purified
- Immunogène
- SRD5 A2 antibody was raised using the N terminal of SRD5 2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
- Top Product
- Discover our top product SRD5A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SRD5A2 Blocking Peptide, catalog no. 33R-6350, is also available for use as a blocking control in assays to test for specificity of this SRD5A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRD0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRD5A2 (Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2) (SRD5A2))
- Autre désignation
- SRD5A2 (SRD5A2 Produits)
- Synonymes
- anticorps S5AR 2, anticorps 5ART2, anticorps SRD5alpha2, anticorps SRD5A2, anticorps Srd5a2, anticorps CH73-233A22.6, anticorps wu:fk70d02, anticorps zgc:109942, anticorps zgc:112208, anticorps zgc:112455, anticorps steroid 5 alpha-reductase 2, anticorps steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2), anticorps 3-oxo-5-alpha-steroid 4-dehydrogenase 2, anticorps steroid-5-alpha-reductase, alpha polypeptide 2a, anticorps steroid-5-alpha-reductase, alpha polypeptide 2b, anticorps SRD5A2, anticorps Srd5a2, anticorps srd5a2, anticorps LOC100125532, anticorps srd5a2a, anticorps srd5a2b
- Sujet
- This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis
-