Neuropilin 1 anticorps (N-Term)
-
- Antigène Voir toutes Neuropilin 1 (NRP1) Anticorps
- Neuropilin 1 (NRP1)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Neuropilin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Neuropilin antibody was raised against the N terminal of NETO2
- Purification
- Affinity purified
- Immunogène
- Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME
- Top Product
- Discover our top product NRP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Neuropilin Blocking Peptide, catalog no. 33R-2574, is also available for use as a blocking control in assays to test for specificity of this Neuropilin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NETO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Neuropilin 1 (NRP1)
- Autre désignation
- Neuropilin (NRP1 Produits)
- Synonymes
- anticorps NRP1, anticorps cd304, anticorps neuropilin, anticorps np-1, anticorps npn-1, anticorps nrp, anticorps nrp-1, anticorps vegf165r, anticorps BDCA4, anticorps CD304, anticorps NP1, anticorps NRP, anticorps VEGF165R, anticorps C530029I03, anticorps NP-1, anticorps NPN-1, anticorps Npn1, anticorps Nrp, anticorps neuropilin 1, anticorps neuropilin 1 L homeolog, anticorps NRP1, anticorps nrp1, anticorps Nrp1, anticorps nrp1.L
- Sujet
- NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size, Signaling Events mediated by VEGFR1 and VEGFR2, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals
-