IL28RA anticorps

N° du produit ABIN636031

Détail du produit anti-IL28RA anticorps

Antigène: IL28RA (Interleukin 28 Receptor, alpha (Interferon, lambda Receptor) (IL28RA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL28RA est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: IL28 R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL28R alpha Blocking Peptide, catalog no. 33R-7511, is also available for use as a blocking control in assays to test for specificity of this IL28R alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL28RA

Antigène: IL28RA (Interleukin 28 Receptor, alpha (Interferon, lambda Receptor) (IL28RA))

Autre désignation: IL28R alpha (IL28RA Produits)

Synonymes: anticorps IFNLR1, anticorps IL28RA, anticorps crf2/12, anticorps ifnlr, anticorps il-28r1, anticorps il28ra, anticorps licr2, anticorps ifnlr1, anticorps CRF2-12, anticorps Il28ra, anticorps CRF2/12, anticorps IFNLR, anticorps IL-28R1, anticorps LICR2, anticorps RGD1562689, anticorps interferon lambda receptor 1, anticorps interferon, lambda receptor 1, anticorps interferon, lambda receptor 1 L homeolog, anticorps IFNLR1, anticorps ifnlr1, anticorps ifnlr1.L, anticorps Ifnlr1

Sujet: IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.

Poids moléculaire: 58 kDa (MW of target protein)