Insulin Receptor anticorps (Middle Region)

N° du produit ABIN636083

L’anticorps anti-Insulin Receptor Polyclonal Lapin est utilisé pour la détection de Insulin Receptor dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour Insulin Receptor anticorps (Middle Region) (ABIN636083)

Antigène: Insulin Receptor (INSR)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Insulin Receptor est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Insulin Receptor anticorps

Épitope: Middle Region

Specificité: INSR antibody was raised against the middle region of INSR

Purification: Affinity purified

Immunogène: INSR antibody was raised using the middle region of INSR corresponding to a region with amino acids ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INSR Blocking Peptide, (ABIN937998), is also available for use as a blocking control in assays to test for specificity of this INSR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Insulin Receptor

Antigène: Insulin Receptor (INSR)

Autre désignation: INSR

Sujet: This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin.

Poids moléculaire: 154 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalisation RTK, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity