Insulin Receptor anticorps (Middle Region)

N° du produit ABIN636083

Détail du produit anti-Insulin Receptor anticorps

Antigène: Insulin Receptor (INSR)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Insulin Receptor est non-conjugé

Application: Western Blotting (WB)

Specificité: INSR antibody was raised against the middle region of INSR

Purification: Affinity purified

Immunogène: INSR antibody was raised using the middle region of INSR corresponding to a region with amino acids ENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

INSR Blocking Peptide, catalog no. 33R-2612, is also available for use as a blocking control in assays to test for specificity of this INSR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Insulin Receptor

Antigène: Insulin Receptor (INSR)

Autre désignation: INSR (INSR Produits)

Synonymes: anticorps CD220, anticorps HHF5, anticorps 4932439J01Rik, anticorps D630014A15Rik, anticorps IR, anticorps IR-A, anticorps IR-B, anticorps 18402, anticorps CG18402, anticorps DIHR, anticorps DILR, anticorps DIR, anticorps DIRH, anticorps DIRbeta, anticorps DInR, anticorps DInr, anticorps Dir-a, anticorps Dir-b, anticorps Dmel\\CG18402, anticorps INR, anticorps INS, anticorps Inr, anticorps Inr-alpha, anticorps Inr-beta, anticorps InsR, anticorps dINR, anticorps dIR, anticorps dIRH, anticorps dInR, anticorps dInr, anticorps dInsR, anticorps dinr, anticorps dir, anticorps er10, anticorps inr, anticorps insulin/insulin-like growth factor receptor, anticorps l(3)05545, anticorps l(3)93Dj, anticorps l(3)er10, anticorps lnR, anticorps ir-A, anticorps CTK-1, anticorps ir, anticorps INSR, anticorps NV14476, anticorps cd220, anticorps hhf5, anticorps insulin receptor, anticorps Insulin-like receptor, anticorps insulin receptor L homeolog, anticorps INSR, anticorps Insr, anticorps InR, anticorps LOC100122567, anticorps LOC100451802, anticorps insr.L

Sujet: This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. INSR mediates the metabolic functions of insulin.

Poids moléculaire: 154 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Signalisation RTK, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity