RICTOR anticorps

N° du produit ABIN8111026

Cet anticorps Lapin Polyclonal détecte spécifiquement RICTOR dans IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Chien, Cheval, Boeuf (Vache), Porc et Lapin.

Aperçu rapide pour RICTOR anticorps (ABIN8111026)

Antigène: RICTOR (RPTOR Independent Companion of mTOR, Complex 2 (RICTOR))

Reactivité: Humain, Souris, Rat, Chien, Cheval, Boeuf (Vache), Porc, Lapin

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RICTOR est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-RICTOR anticorps

Fonction: RICTOR Antibody

Séquence: GENDLKFTKN FGTENHRENT SRERLVVESS TSSHMKIRSQ SFNTDTTTSG

Homologie: Cow: 93%, Dog: 100%, Horse: 100%, Human: 100%, Mouse: 93%, Pig: 93%, Rabbit: 100%, Rat: 100%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP61411-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur RICTOR

Antigène: RICTOR (RPTOR Independent Companion of mTOR, Complex 2 (RICTOR))

Autre désignation: RICTOR

Sujet:

Background Information: RICTOR and MTOR (FRAP1, MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008]

Gene Name: RPTOR independent companion of MTOR, complex 2

Alternative Symbols: PIA, AVO3, hAVO3

Protein Name: Rapamycin-insensitive companion of mTOR

Poids moléculaire: 192 kDa

ID gène: 253260

NCBI Accession: NP_689969

UniProt: Q6R327

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Actin Filament Polymerization, CXCR4-mediated Signaling Events