anti-Humain Methyl-CpG Binding Domain Protein 5 anticorps pour Immunocytochemistry

Recommended Methyl-CpG Binding Domain Protein 5 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Methyl-CpG Binding Domain Protein 5 (MBD5) Anticorps
  • MBD5
  • MRD1
  • 9430004D19Rik
  • AA536666
  • AI426407
  • C030040A15Rik
  • OTTMUSG00000012483
  • methyl-CpG binding domain protein 5
  • MBD5
  • mbd5
  • Mbd5
Reactivité
Humain
19
7
4
Hôte
Lapin
14
4
Clonalité
Polyclonal
Conjugué
Inconjugué
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
14
14
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN5078000
Produit non disponible pour cette région.

General

Antigène Methyl-CpG Binding Domain Protein 5 (MBD5) Anticorps
Reactivité Humain
(19), (7), (4)
Hôte Lapin
(14), (4)
Clonalité
Polyclonal
Conjugué Inconjugué
(1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(14), (14), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation MBD5 (MBD5 Antibody Extrait)
Sujet Gene Symbol: MBD5
ID gène 55777
Pathways Chromatin Binding

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Methyl-CpG Binding Domain Protein 5 (MBD5) antibody (ABIN5078000) Immunocytochemistry/Immunofluorescence: MBD5 Antibody - Staining of human cell line ...