anti-Humain TIAM2 anticorps pour Immunocytochemistry

Recommended TIAM2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
T-Cell Lymphoma Invasion and Metastasis 2 (TIAM2) Anticorps
  • STEF
  • TIAM-2
  • 3000002F19Rik
  • mKIAA2016
  • TIAM2
  • T-cell lymphoma invasion and metastasis 2
  • T cell lymphoma invasion and metastasis 2
  • T-cell lymphoma invasion and metastasis 2a
  • T-lymphoma invasion and metastasis-inducing protein 2
  • TIAM2
  • Tiam2
  • tiam2a
  • LOC100598161
Reactivité
Humain
41
21
2
2
1
Hôte
Lapin
23
19
10
Clonalité
Polyclonal
Conjugué
Cet anticorp TIAM2 est non-conjugé
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
39
34
5
3
3
2
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4359660
Produit non disponible pour cette région.

General

Antigène T-Cell Lymphoma Invasion and Metastasis 2 (TIAM2) Anticorps
Reactivité Humain
(41), (21), (2), (2), (1)
Hôte Lapin
(23), (19), (10)
Clonalité
Polyclonal
Conjugué Cet anticorp TIAM2 est non-conjugé
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(39), (34), (5), (3), (3), (2), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-TIAM2 anticorps

Détail du antigène TIAM2 Information d'application Stockage References for anti-TIAM2 antibody (ABIN4359660) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:IKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVL
Isotype IgG
Plasmids, Primers & others

Détail du antigène TIAM2

Détail du produit anti-TIAM2 anticorps Information d'application Stockage References for anti-TIAM2 antibody (ABIN4359660) Images Haut de la page
Antigène
Autre désignation TIAM2 (TIAM2 Antibody Extrait)
Sujet Gene Symbol: TIAM2
ID gène 26230
Pathways Neurotrophin Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit anti-TIAM2 anticorps Détail du antigène TIAM2 Stockage References for anti-TIAM2 antibody (ABIN4359660) Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-TIAM2 anticorps Détail du antigène TIAM2 Information d'application References for anti-TIAM2 antibody (ABIN4359660) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-TIAM2 antibody (ABIN4359660)

Détail du produit anti-TIAM2 anticorps Détail du antigène TIAM2 Information d'application Stockage Images Haut de la page
Produit citée dans:

Artym, Swatkoski, Matsumoto, Campbell, Petrie, Dimitriadis, Li, Mueller, Bugge, Gucek, Yamada: "Dense fibrillar collagen is a potent inducer of invadopodia via a specific signaling network." dans: The Journal of cell biology, Vol. 208, Issue 3, pp. 331-50, 2015

Images

Détail du produit anti-TIAM2 anticorps Détail du antigène TIAM2 Information d'application Stockage References for anti-TIAM2 antibody (ABIN4359660) Haut de la page
Images (Fournisseur)
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-T-Cell Lymphoma Invasion and Metastasis 2 (TIAM2) antibody (ABIN4359660) Immunohistochemistry-Paraffin: TIAM2 Antibody - Staining of human cerebral cortex sh...
Immunofluorescence (IF) image for anti-T-Cell Lymphoma Invasion and Metastasis 2 (TIAM2) antibody (ABIN4359660) Immunocytochemistry/Immunofluorescence: TIAM2 Antibody - Staining of human cell line...