anti-Humain SHC2 anticorps pour Immunofluorescence

Recommended SHC2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) Anticorps
  • SCK
  • SHCB
  • SLI
  • 6720466E06
  • ShcB
  • Sli
  • SHC adaptor protein 2
  • SHC (Src homology 2 domain containing) transforming protein 2
  • SHC2
  • Shc2
Reactivité
Humain
38
28
25
4
1
Hôte
Lapin
35
4
2
Clonalité
Polyclonal
Conjugué
Cet anticorp SHC2 est non-conjugé
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
29
13
10
5
3
3
2
2
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4353346
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN6257771 ELISA ICC IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN6242869 FACS IF WB Rabbit Ig Fraction AA 129-163 Connectez-vous pour afficher Polyclonal 0

General

Antigène SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) Anticorps
Reactivité Humain
(38), (28), (25), (4), (1)
Hôte Lapin
(35), (4), (2)
Clonalité
Polyclonal
Conjugué Cet anticorp SHC2 est non-conjugé
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(29), (13), (10), (5), (3), (3), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-SHC2 anticorps

Détail du antigène SHC2 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:EHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEEQLRQEPWYHGRMSRRAAERMLRADGD
Isotype IgG
Plasmids, Primers & others

Détail du antigène SHC2

Détail du produit anti-SHC2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation SHC2 (SHC2 Antibody Extrait)
Sujet Gene Symbol: SHC2
ID gène 25759
Pathways Signalisation RTK, Neurotrophin Signaling Pathway, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals, VEGF Signaling

Information d'application

Détail du produit anti-SHC2 anticorps Détail du antigène SHC2 Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-SHC2 anticorps Détail du antigène SHC2 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-SHC2 anticorps Détail du antigène SHC2 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) antibody (ABIN4353346) Immunohistochemistry-Paraffin: SHC2 Antibody [NBP1-87076] - Staining of human hippoca...
Western Blotting (WB) image for anti-SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) antibody (ABIN4353346) Western Blot: SHC2 Antibody [NBP1-87076] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32,...
Immunofluorescence (IF) image for anti-SHC (Src Homology 2 Domain Containing) Transforming Protein 2 (SHC2) antibody (ABIN4353346) Immunocytochemistry/Immunofluorescence: SHC2 Antibody [NBP1-87076] - Immunofluorescen...