anti-Humain WASF2 anticorps pour Immunofluorescence

Recommended WASF2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
WAS Protein Family, Member 2 (WASF2) Anticorps
  • zgc:56010
  • WASF2
  • scar2
  • wave2
  • IMD2
  • SCAR2
  • WASF4
  • WAVE2
  • dJ393P12.2
  • AW742646
  • D4Ertd13e
  • WAS protein family, member 2
  • WAS protein family member 2
  • WAS protein family member 2 L homeolog
  • wasf2
  • WASF2
  • wasf2.L
  • Wasf2
Reactivité
Humain
77
39
32
5
5
5
5
4
3
3
1
1
Hôte
Lapin
73
8
Clonalité
Polyclonal
Conjugué
Cet anticorp WASF2 est non-conjugé
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
61
44
19
13
10
5
4
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4365925
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN6257551 ELISA ICC IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène WAS Protein Family, Member 2 (WASF2) Anticorps
Reactivité Humain
(77), (39), (32), (5), (5), (5), (5), (4), (3), (3), (1), (1)
Hôte Lapin
(73), (8)
Clonalité
Polyclonal
Conjugué Cet anticorp WASF2 est non-conjugé
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(61), (44), (19), (13), (10), (5), (4), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-WASF2 anticorps

Détail du antigène WASF2 Information d'application Stockage Images
Purification Immunogen affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: DSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP
Plasmids, Primers & others

Détail du antigène WASF2

Détail du produit anti-WASF2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation WASF2 (WASF2 Antibody Extrait)
Sujet Gene Symbol: WASF2
ID gène 10163
UniProt Q9Y6W5
Pathways Signalisation RTK

Information d'application

Détail du produit anti-WASF2 anticorps Détail du antigène WASF2 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-WASF2 anticorps Détail du antigène WASF2 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-WASF2 anticorps Détail du antigène WASF2 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-WAS Protein Family, Member 2 (WASF2) antibody (ABIN4365925) Immunocytochemistry/Immunofluorescence: WASF2 Antibody - Immunofluorescent staining ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-WAS Protein Family, Member 2 (WASF2) antibody (ABIN4365925) Immunohistochemistry-Paraffin: WASF2 Antibody - Staining of human gallbladder shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WAS Protein Family, Member 2 (WASF2) antibody (ABIN4365925) Immunohistochemistry-Paraffin: WASF2 Antibody - Staining of human liver shows low ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WAS Protein Family, Member 2 (WASF2) antibody (ABIN4365925) Immunohistochemistry-Paraffin: WASF2 Antibody - Staining in human esophagus and live...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-WAS Protein Family, Member 2 (WASF2) antibody (ABIN4365925) Immunohistochemistry-Paraffin: WASF2 Antibody - Staining of human esophagus shows hi...