PLG anticorps (Middle Region)
-
- Antigène Voir toutes PLG Anticorps
- PLG (Plasminogen (PLG))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLG est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Plasminogen antibody was raised against the middle region of PLG
- Purification
- Affinity purified
- Immunogène
- Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
- Top Product
- Discover our top product PLG Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." dans: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, (2006) (PubMed).
: "A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro." dans: Biochemical and biophysical research communications, Vol. 338, Issue 2, pp. 1000-4, (2005) (PubMed).
: "
-
The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated." dans: Biochemical and biophysical research communications, Vol. 346, Issue 3, pp. 746-50, (2006) (PubMed).
-
- Antigène
- PLG (Plasminogen (PLG))
- Autre désignation
- Plasminogen (PLG Produits)
- Synonymes
- anticorps wu:fb70e09, anticorps PLG, anticorps LPA, anticorps plg, anticorps Ab1-346, anticorps AI649309, anticorps Pg, anticorps plasminogen, anticorps plg, anticorps PLG, anticorps Plg
- Sujet
- The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.
- Poids moléculaire
- 88 kDa (MW of target protein)
- Pathways
- Système du Complément, Lipid Metabolism
-