CD59 anticorps (AA 25-104)
-
- Antigène Voir toutes CD59 Anticorps
- CD59
-
Épitope
- AA 25-104
-
Reactivité
- Lapin
-
Hôte
-
Cobaye
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD59 est non-conjugé
-
Application
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))
- Séquence
- MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-SLMCYH CLLPSPNCST VTNCTPNHDA CLTAVSGPRV YRQCWRYEDC NFEFISNRLE ENSLKYNCCR KDLCNGPEDD GTAL
- Specificité
- It has been selected for its ability to recognize CD59 in immunohistochemical staining and Western blotting.
- Purification
- Affinity Chromatography
- Immunogène
- CD59 (AA 25-104)
- Isotype
- IgG
- Top Product
- Discover our top product CD59 Anticorps primaire
-
-
- Indications d'application
-
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user. - Commentaires
-
Content: The quality control contains recombinant CD59 (Ser25~Leu104) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % . - Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles
- Stock
- 4 °C
- Stockage commentaire
- Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
- Date de péremption
- 12 months
-
- Antigène
- CD59
- Autre désignation
- Protectin (CD59) (CD59 Produits)
- Synonymes
- anticorps 16.3A5, anticorps 1F5, anticorps EJ16, anticorps EJ30, anticorps EL32, anticorps G344, anticorps HRF-20, anticorps HRF20, anticorps MAC-IP, anticorps MACIF, anticorps MEM43, anticorps MIC11, anticorps MIN1, anticorps MIN2, anticorps MIN3, anticorps MIRL, anticorps MSK21, anticorps p18-20, anticorps Cd59a, anticorps Cd59b, anticorps MACIP, anticorps CD59 molecule (CD59 blood group), anticorps CD59 molecule, anticorps CD59, anticorps Cd59
- Pathways
- Système du Complément
-