SLC12A1 anticorps (AA 52-83)
-
- Antigène Voir toutes SLC12A1 Anticorps
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
-
Épitope
- AA 52-83
-
Reactivité
- Humain, Rat, Souris, Singe
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC12A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Specificité
- Kidney specific.
- Purification
- Immunogen affinity purified
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SLC12A1 Anticorps primaire
-
-
- Indications d'application
- Approved: IHC, IHC-P (0.1 - 0.5 μg/mL), WB (0.5 - 1 μg/mL)
- Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- avoid freeze thaw cycles
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
-
- Antigène
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
- Autre désignation
- SLC12A1 / NKCC2 (SLC12A1 Produits)
- Synonymes
- anticorps slc12a1, anticorps SLC12A1, anticorps DKFZp469A2020, anticorps BSC1, anticorps NKCC2, anticorps Nkcc2, anticorps AI788571, anticorps D630042G03Rik, anticorps mBSC1, anticorps urehr3, anticorps si:ch211-220f12.1, anticorps solute carrier family 12 member 1, anticorps solute carrier family 12, member 1, anticorps si:ch211-220f12.1, anticorps SLC12A1, anticorps Slc12a1
- Sujet
-
Name/Gene ID: SLC12A1
Subfamily: Cation:chloride symporter
Family: Transporter
Synonyms: SLC12A1, BSC1, MBSC1, Na-K-2Cl cotransporter, NKCC2A variant A, RBSC, NKCC2 - ID gène
- 6557
-