Integrin beta 2 anticorps (N-Term)

N° du produit ABIN3031373

Détail du produit anti-Integrin beta 2 anticorps

Antigène: Integrin beta 2 (ITGB2)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Integrin beta 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: An amino acid sequence from the N-terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) was used as the immunogen for this CD18 antibody.

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting amounts. Titration of the CD18 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CD18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Integrin beta 2

Antigène: Integrin beta 2 (ITGB2)

Autre désignation: CD18 (ITGB2 Produits)

Synonymes: anticorps CD18, anticorps LAD, anticorps LCAMB, anticorps LFA-1, anticorps MAC-1, anticorps MF17, anticorps MFI7, anticorps 2E6, anticorps AI528527, anticorps Cd18, anticorps Lfa1, anticorps ITGB2, anticorps itgb2, anticorps itgb2-a, anticorps itgb2-b, anticorps integrin subunit beta 2, anticorps integrin beta 2, anticorps integrin subunit beta 2 S homeolog, anticorps ITGB2, anticorps Itgb2, anticorps itgb2.S

Sujet: The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the ""inside-out"" signaling pathways.

UniProt: P05107

Pathways: Signalisation NF-kappaB, Activation of Innate immune Response, Toll-Like Receptors Cascades, Activated T Cell Proliferation