PRKAB1 anticorps (N-Term)

N° du produit ABIN3043359

Détail du produit anti-PRKAB1 anticorps

Antigène: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Épitope: AA 32-68, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKAB1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1(PRKAB1) detection. Tested with WB in Human.

Séquence: DRPKILMDSP EDADLFHSEE IKAPEKEEFL AWQHDLE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1(PRKAB1) detection. Tested with WB in Human.
Gene Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit
Protein Name: 5'-AMP-activated protein kinase subunit beta-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PRKAB1

Antigène: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Autre désignation: PRKAB1 (PRKAB1 Produits)

Synonymes: anticorps AMPK, anticorps HAMPKb, anticorps 1300015D22Rik, anticorps AU021155, anticorps E430008F22, anticorps MGC82489, anticorps prkab1, anticorps wu:fk93d05, anticorps wu:fw87e09, anticorps zgc:56652, anticorps zgc:76975, anticorps zgc:92228, anticorps protein kinase AMP-activated non-catalytic subunit beta 1, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit, b, anticorps protein kinase, AMP-activated, beta 1 non-catalytic subunit, a, anticorps PRKAB1, anticorps Prkab1, anticorps prkab1.S, anticorps prkab1, anticorps prkab1b, anticorps prkab1a

Sujet: 5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.

Synonyms: 1300015D22Rik antibody|5''-AMP-activated protein kinase subunit beta-1 antibody|AAKB1_HUMAN antibody|AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1 antibody|AMP-activated, noncatalytic, beta-1 antibody|AMPK antibody|AMPK beta 1 chain antibody|AMPK subunit beta-1 antibody|AMPK-BETA-1 antibody|AMPKb antibody|AU021155 antibody|E430008F22 antibody| HAMPKb antibody|MGC17785 antibody|PRKAB1 antibody

ID gène: 5564

UniProt: Q9Y478

Pathways: AMPK Signaling, L'effet Warburg