CYP3A4 anticorps (Middle Region)

N° du produit ABIN4886557

Détail du produit anti-CYP3A4 anticorps

Antigène: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Épitope: AA 237-277, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP3A4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Cytochrome P450 3A4(CYP3A4) detection. Tested with WB, IHC-P in Human.

Séquence: NICVFPREVT NFLRKSVKRM KESRLEDTQK HRVDFLQLMI D

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cytochrome P450 3A4(CYP3A4) detection. Tested with WB, IHC-P in Human.
Gene Name: cytochrome P450 family 3 subfamily A member 4
Protein Name: Cytochrome P450 3A4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (237-277aa NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CYP3A4

Antigène: CYP3A4 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 4 (CYP3A4))

Autre désignation: CYP3A4 (CYP3A4 Produits)

Synonymes: anticorps CP33, anticorps CP34, anticorps CYP3A, anticorps CYP3A3, anticorps CYPIIIA3, anticorps CYPIIIA4, anticorps HLP, anticorps NF-25, anticorps P450C3, anticorps P450PCN1, anticorps MGC108372, anticorps CYP3A80, anticorps CYP3A4, anticorps CYP3A21, anticorps CYPIIIA21, anticorps CYP3A12, anticorps cytochrome P450 family 3 subfamily A member 4, anticorps cytochrome P450 family 3 subfamily A member 43, anticorps cytochrome P450 3A4, anticorps cytochrome P450, subfamily IIIA, polypeptide 4, anticorps cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4, anticorps cytochrome P450, family 3, subfamily A, polypeptide 4, anticorps CYP3A4, anticorps CYP3A43, anticorps PTRG_01782, anticorps PTRG_06060, anticorps cyp3a4

Sujet: Cytochrome P450 3A4 (abbreviated CYP3A4), is an important enzyme in the body, mainly found in the liver and in the intestine. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist, however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Synonyms: CP33 | CP34 | CYP3 | CYP3A | CYP3A3 | CYP3A4 | CYPIIIA3 | CYPIIIA4 | HLP | NF 25 | NF25 | Nifedipine oxidase | P450 PCN1 | P450C3 | P450PCN1 | P08684

ID gène: 1576

UniProt: P08684

Pathways: Steroid Hormone Biosynthesis