APH1A anticorps

N° du produit ABIN4950145

Détail du produit anti-APH1A anticorps

Antigène: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APH1A est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the APH1A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the APH1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur APH1A

Antigène: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Autre désignation: APH1A (APH1A Produits)

Synonymes: anticorps 6530402N02Rik, anticorps APH-1, anticorps APH-1A, anticorps CGI-78, anticorps RGD1311546, anticorps APH-1a, anticorps aph-1 homolog A, gamma-secretase subunit, anticorps aph-1 homolog A, gamma secretase subunit L homeolog, anticorps aph-1 homolog A, gamma secretase subunit, anticorps anterior pharynx defective 1 homolog A (C. elegans), anticorps aph1 homolog A, gamma secretase subunit, anticorps acylamino-acid-releasing enzyme-like, anticorps APH1A, anticorps aph1a.L, anticorps Aph1a, anticorps LOC100219182

Sujet: APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

UniProt: Q96BI3

Pathways: Signalisation Notch, Neurotrophin Signaling Pathway