Ataxin 2 anticorps

N° du produit ABIN4950268

Détail du produit anti-Ataxin 2 anticorps

Antigène: Ataxin 2 (ATXN2)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ataxin 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL of human ATXN2 were used as the immunogen for the ATX2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ATX2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,Immunocytochemistry : 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ATX2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Ataxin 2

Antigène: Ataxin 2 (ATXN2)

Autre désignation: Ataxin-2 / ATXN2 (ATXN2 Produits)

Synonymes: anticorps ASL13, anticorps ATX2, anticorps SCA2, anticorps TNRC13, anticorps 9630045M23Rik, anticorps AW544490, anticorps Sca2, anticorps ATXN2, anticorps MGC115230, anticorps ataxin 2, anticorps ataxin 2 L homeolog, anticorps ATXN2, anticorps Atxn2, anticorps atxn2.L

Sujet: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

UniProt: Q99700

Pathways: Ribonucleoprotein Complex Subunit Organization