LCAT anticorps
-
- Antigène Voir toutes LCAT Anticorps
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LCAT est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogène
- Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody.
- Isotype
- IgG
- Top Product
- Discover our top product LCAT Anticorps primaire
-
-
- Indications d'application
- Optimal dilution of the LCAT antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Stock
- -20 °C
- Stockage commentaire
- After reconstitution, the LCAT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Antigène
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
- Autre désignation
- LCAT (LCAT Produits)
- Synonymes
- anticorps AI046659, anticorps D8Wsu61e, anticorps MGC82035, anticorps lcat, anticorps MGC88964, anticorps LCAT, anticorps lecithin-cholesterol acyltransferase, anticorps lecithin cholesterol acyltransferase, anticorps lecithin-cholesterol acyltransferase L homeolog, anticorps solute carrier family 12 member 4, anticorps fragile site, aphidicolin type, common, fra(13)(q13.2), anticorps LCAT, anticorps Lcat, anticorps lcat.L, anticorps lcat, anticorps SLC12A4, anticorps FRA13A
- Sujet
- LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).
- UniProt
- P16301
- Pathways
- Lipid Metabolism
-