LCAT anticorps (Lecithin-Cholesterol Acyltransferase)

Details for Product anti-LCAT Antibody No. ABIN4951595
Antigène
  • AI046659
  • D8Wsu61e
  • MGC82035
  • lcat
  • MGC88964
  • LCAT
  • lecithin-cholesterol acyltransferase
  • lecithin cholesterol acyltransferase
  • lecithin-cholesterol acyltransferase L homeolog
  • solute carrier family 12 member 4
  • fragile site, aphidicolin type, common, fra(13)(q13.2)
  • LCAT
  • Lcat
  • lcat.L
  • lcat
  • SLC12A4
  • FRA13A
Reactivité
Humain, Souris, Rat (Rattus)
107
49
44
6
5
5
4
4
4
4
2
1
1
Hôte
Lapin
126
7
2
Clonalité
Polyclonal
Conjugué
Cet anticorp LCAT est non-conjugé
17
6
4
3
3
3
3
3
3
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
110
44
42
21
21
13
13
11
8
7
2
2
1
Options
Immunogène Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others LCAT products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation LCAT (LCAT Antibody Extrait)
Sujet LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).
UniProt P16301
Pathways Lipid Metabolism
Indications d'application Optimal dilution of the LCAT antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the LCAT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Lecithin-Cholesterol Acyltransferase (LCAT) antibody (ABIN4951595) Western blot testing of 1) rat brain, 2) mouse testis, 3) human HepG2 and 4) human He...
Avez-vous cherché autre chose?