MDM4-binding Protein anticorps (Mdm4-binding Protein)

Details for Product anti-MDM4 Antibody No. ABIN4951699
Antigène
  • mdmx
  • HDMX
  • MDMX
  • MRP1
  • wu:fa09h09
  • wu:fi33d10
  • 4933417N07Rik
  • AA414968
  • AL023055
  • AU018793
  • AU021806
  • C85810
  • Mdmx
  • MDM4, p53 regulator S homeolog
  • MDM4, p53 regulator
  • transformed mouse 3T3 cell double minute 4
  • mdm4.S
  • MDM4
  • Mdm4
  • mdm4
Reactivité
Humain, Souris
168
71
62
5
4
4
3
2
1
Hôte
Lapin
117
52
1
Clonalité
Polyclonal
Conjugué
Cet anticorp MDM4-binding Protein est non-conjugé
7
4
4
4
4
4
4
4
4
2
2
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
137
69
53
46
29
13
11
5
2
2
1
1
Options
Immunogène Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.
Isotype IgG
Purification Antigen affinity
Plasmids, Primers & others Plasmids, Primers & others MDM4-binding Protein products on genomics-online (e.g. as negative or positive controls)
Antigène
Autre désignation MDM4 / MDMX (MDM4 Antibody Extrait)
Sujet Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
UniProt O15151
Pathways Cycle Cellulaire
Indications d'application Optimal dilution of the MDM4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
Restrictions For Research Use only
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Stock -20 °C
Stockage commentaire After reconstitution, the MDM4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Images (Fournisseur)
Image no. 1 for anti-Mdm4-binding Protein (MDM4) antibody (ABIN4951699) Western blot testing of 1) mouse testis and 2) human 22RV1 lysate with MDM4 antibody....
Avez-vous cherché autre chose?