MDM4-binding Protein anticorps

N° du produit ABIN4951699

Détail du produit anti-MDM4-binding Protein anticorps

Antigène: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDM4-binding Protein est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MDM4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MDM4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MDM4-binding Protein

Antigène: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Autre désignation: MDM4 / MDMX (MDM4 Produits)

Synonymes: anticorps mdmx, anticorps HDMX, anticorps MDMX, anticorps MRP1, anticorps wu:fa09h09, anticorps wu:fi33d10, anticorps 4933417N07Rik, anticorps AA414968, anticorps AL023055, anticorps AU018793, anticorps AU021806, anticorps C85810, anticorps Mdmx, anticorps MDM4, p53 regulator S homeolog, anticorps MDM4, p53 regulator, anticorps transformed mouse 3T3 cell double minute 4, anticorps mdm4.S, anticorps MDM4, anticorps Mdm4, anticorps mdm4

Sujet: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

UniProt: O15151

Pathways: Cycle Cellulaire