MAP2K3 anticorps

N° du produit ABIN4951735

Détail du produit anti-MAP2K3 anticorps

Antigène: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP2K3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3 were used as the immunogen for the MKK3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MKK3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MKK3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur MAP2K3

Antigène: MAP2K3 (Mitogen-Activated Protein Kinase Kinase 3 (MAP2K3))

Autre désignation: MEK3 / MAP2K3 / MKK3 (MAP2K3 Produits)

Synonymes: anticorps MAPKK3, anticorps MEK3, anticorps MKK3, anticorps PRKMK3, anticorps SAPKK-2, anticorps SAPKK2, anticorps AW212142, anticorps Prkmk3, anticorps mMKK3b, anticorps Mkk3, anticorps mitogen-activated protein kinase kinase 3, anticorps mitogen activated protein kinase kinase 3, anticorps MAP kinase activator XMEK3, anticorps MAP2K3, anticorps Map2k3, anticorps map2k3

Sujet: Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2.

UniProt: P46734

Pathways: Signalisation MAPK, Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2