NR3C2 anticorps

N° du produit ABIN4951773

Détail du produit anti-NR3C2 anticorps

Antigène: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR3C2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein were used as the immunogen for the MR antibody. This sequence is common to isoforms 1, 3 and 4.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the MR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NR3C2

Antigène: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Autre désignation: Mineralocorticoid Receptor / MR (NR3C2 Produits)

Synonymes: anticorps mr, anticorps si:ch211-189l17.1, anticorps LOC100302443, anticorps NR3C2, anticorps LOC443144, anticorps MLR, anticorps MR, anticorps MCR, anticorps NR3C2VIT, anticorps Mlr, anticorps mlr, anticorps nuclear receptor subfamily 3, group C, member 2, anticorps nuclear receptor subfamily 3 group C member 2, anticorps mineralocorticoid receptor, anticorps nuclear receptor subfamily 3 group C member 2 L homeolog, anticorps nr3c2, anticorps NR3C2, anticorps LOC443144, anticorps Nr3c2, anticorps nr3c2.L

Sujet: NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

UniProt: P08235

Pathways: ACE Inhibitor Pathway, Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway