SMURF2 anticorps

N° du produit ABIN4952623

Détail du produit anti-SMURF2 anticorps

Antigène: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMURF2 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogène: Amino acids DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ of human SMURF2 were used as the immunogen for the SMURF2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SMURF2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the SMURF2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur SMURF2

Antigène: SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2 (SMURF2))

Autre désignation: SMURF2 (SMURF2 Produits)

Synonymes: anticorps SMURF2, anticorps 2810411E22Rik, anticorps AI558114, anticorps AI649275, anticorps RGD1310067, anticorps wu:fb82a11, anticorps wu:fc41c02, anticorps SMAD specific E3 ubiquitin protein ligase 2, anticorps SMAD specific E3 ubiquitin protein ligase 2 S homeolog, anticorps SMURF2, anticorps smurf2, anticorps Smurf2, anticorps smurf2.S

Sujet: E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression

UniProt: Q9HAU4