WNT7A anticorps

N° du produit ABIN4953110

Détail du produit anti-WNT7A anticorps

Antigène: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT7A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogène: Amino acids YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK of human WNT7A were used as the immunogen for the WNT7A antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the WNT7A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the WNT7A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur WNT7A

Antigène: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Autre désignation: WNT7A (WNT7A Produits)

Synonymes: anticorps wnt7a, anticorps AI849442, anticorps Wnt-7a, anticorps px, anticorps tw, anticorps Xwnt-7a, anticorps wnt-7a, anticorps wnt7a-A, anticorps Wnt family member 7A, anticorps wingless-type MMTV integration site family, member 7Aa, anticorps wingless-type MMTV integration site family, member 7A, anticorps wingless-type MMTV integration site family member 7A S homeolog, anticorps WNT7A, anticorps wnt7aa, anticorps Wnt7a, anticorps wnt7a.S

Sujet: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.

UniProt: O00755

Pathways: Signalisation WNT, Stem Cell Maintenance, Asymmetric Protein Localization