HLA-DQB1 anticorps

N° du produit ABIN5647144

Détail du produit anti-HLA-DQB1 anticorps

Antigène: HLA-DQB1 (Major Histocompatibility Complex, Class II, DQ beta 1 (HLA-DQB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HLA-DQB1 est non-conjugé

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogène: Amino acids DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR were used as the immunogen for the HLA-DQB1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HLA-DQB1 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the HLA-DQB1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur HLA-DQB1

Antigène: HLA-DQB1 (Major Histocompatibility Complex, Class II, DQ beta 1 (HLA-DQB1))

Autre désignation: HLA-DQB1 (HLA-DQB1 Produits)

Synonymes: anticorps CELIAC1, anticorps HLA-DQB, anticorps IDDM1, anticorps mhc-DRB, anticorps DLA-DQB, anticorps MAMU-DQB1, anticorps LOC100172120, anticorps DKFZp469C0237, anticorps major histocompatibility complex, class II, DQ beta 1, anticorps HLA-DQB1, anticorps PATR-DQB1, anticorps DLA-DQB1, anticorps MAMU-DQB1, anticorps LOC100172120

Sujet: Major histocompatibility complex, class II, DQ beta 1, also known as HLA-DQB1, is a human gene and also denotes the genetic locus that contains this gene. HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.

UniProt: P01920

Pathways: TCR Signaling, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints