ERBB4 anticorps

N° du produit ABIN5708421

Détail du produit anti-ERBB4 anticorps

Antigène: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERBB4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR from the human protein were used as the immunogen for the ERBB4 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ERBB4 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ERBB4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ERBB4

Antigène: ERBB4 (V-Erb-A erythroblastic Leukemia Viral Oncogene Homolog 4 (Avian) (ERBB4))

Autre désignation: ERBB4 / HER4 (ERBB4 Produits)

Synonymes: anticorps erbb4, anticorps si:ch211-227n20.1, anticorps Her4, anticorps c-erbB-4, anticorps HER4, anticorps p180erbB4, anticorps erb-b2 receptor tyrosine kinase 4, anticorps erb-b2 receptor tyrosine kinase 4a, anticorps v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian), anticorps erb-b2 receptor tyrosine kinase 4 L homeolog, anticorps receptor tyrosine-protein kinase ErbB-4, anticorps ERBB4, anticorps erbb4a, anticorps erbb4, anticorps erbb4.L, anticorps Tsp_13582, anticorps Erbb4

Sujet: ERBB4 (V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is cleaved by a metalloprotease.

UniProt: Q15303

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway