SERPINB5 anticorps

N° du produit ABIN629846

Détail du produit anti-SERPINB5 anticorps

Antigène: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERPINB5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SERPINB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Information d'application

Indications d'application: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINB5 Blocking Peptide, catalog no. 33R-6892, is also available for use as a blocking control in assays to test for specificity of this SERPINB5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERPINB5

Antigène: SERPINB5 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 5 (SERPINB5))

Autre désignation: SERPINB5 (SERPINB5 Produits)

Synonymes: anticorps 1110036M19Rik, anticorps AI462524, anticorps AI646751, anticorps Maspin, anticorps PI-5, anticorps Spi7, anticorps ovalbumin, anticorps PI5, anticorps maspin, anticorps Pi5, anticorps serine (or cysteine) peptidase inhibitor, clade B, member 5, anticorps serpin family B member 5, anticorps serpin peptidase inhibitor, clade B (ovalbumin), member 5 S homeolog, anticorps Serpinb5, anticorps SERPINB5, anticorps serpinb5.S

Sujet: As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Signalisation p53